DPCstruct | MC3685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 108 ± 12 aa |
| Standard deviation of domain lengths | 12.00 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182Y5D4 | 7-111 | TAPMFFRILSKFPQSFSFCFAYGSGVKQQLGYESVRSKRNMIDLIYVVDNAHRWHTANLDQNFEHYSGMRLLGGDVIAKYQETFGAR… |
| A0A183E9Q1 | 4-95 | RLSQLLDVLPRDTVEFACAYGSGAVSQSGEKTAGKMVDFIVASQNSSRFHELNLEQNPRHYSALRFLGHQRITRLQRNYAARVYCNT… |
| A0A482RXJ2 | 5-109 | None |
| A0A0V0Y3V8 | 3-98 | None |
| A0A2K5QJE0 | 6-110 | None |
| A0A3Q2R3H9 | 1-102 | None |
| A0A0D6M8W9 | 1-99 | None |
| A0A6A1QCH6 | 1-107 | None |
| A0A7R8W9P4 | 16-130 | None |
| A0A077ZJX3 | 156-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.