DPCstruct | MC36844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 66 ± 3 aa |
| Standard deviation of domain lengths | 3.10 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 42.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1C5L2 | 1-65 | MSGRFRSFFQLYLPRDSDHPGKKRKIVNCGAVGLTLQVGRTAVGEVVHRIDPESINVVYGGFSAK |
| D7FM29 | 424-495 | RPEDTVVCVGHSLYFRSFFRCFLPQSAVHDAKKKKMVNCGVVAFTLESGVYEGRQAYKIEPDSIVSVYGGFK |
| A0A7S1BPI9 | 106-169 | None |
| A0A813DFC3 | 681-741 | None |
| X6NRA1 | 173-237 | None |
| A0A813KFV8 | 27-92 | None |
| G0UU92 | 110-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.