DPCstruct | MC36843
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 72 ± 6 aa |
| Standard deviation of domain lengths | 6.38 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 48.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00596 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4IX30 | 12-67 | PAVLVHSHGPFAWGKNAADAVHNAVVLEECAYMGLFSRQLAPQLPDMQPELLDKHY |
| A0A380FMU8 | 1-72 | MQFQLFLLQGHAPFVWAKDCEHAVMNAVVLEEVCKMNLFTQQLNAYAKALPEEILNKHYERKHGENAYYGQK |
| A0A0M6WZ71 | 73-141 | None |
| A0A1V4HPS0 | 1-77 | None |
| A0A379AFF9 | 27-101 | None |
| A0A645C6T4 | 25-99 | None |
| A8RV42 | 63-137 | None |
| E6PZK4 | 28-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.