DPCstruct | MC36842
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 108 ± 11 aa |
| Standard deviation of domain lengths | 11.20 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 94.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0471 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380FM28 | 1-115 | MVVMYILNKDYVEADFKIVTGFIEPHFFAGFSGGPKGIMPGIAGIETIMTFHNAKMIGDMRSTWGNMADNPVQDMTREINAMCKPDF… |
| A0A3A0HTK2 | 7-117 | CDVYLNKDYVESDFKIVTGFIEPHFFAGFSGGPKGIMPGIAGIETIMTFHNAKMIGDIRSTWGNMQDNPVQNMTREINAMCKPDFML… |
| A0A2E5KGG0 | 391-498 | None |
| A0A1Y4CGP2 | 156-264 | None |
| X1LJP6 | 109-198 | None |
| A0A7E4SF04 | 836-942 | None |
| A0A7X7KN72 | 43-146 | None |
| A0A7V3QXX1 | 162-257 | None |
| A0A4R5JIA9 | 155-244 | None |
| A0A3D3DFD6 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.