DPCstruct | MC36839
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 64 ± 5 aa |
| Standard deviation of domain lengths | 5.02 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 60.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0374 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5KYD6 | 1-75 | MFNFEGGCYAKVINLDKESEPDIYNAIKRDALLENVTVDAEGKIDFNDKSTTENTRVSYPIYHITNIVKPVSHAP |
| A0A150FTB8 | 137-198 | AKCIGLKPETEPEIWNAIRFGTVLENVDYDPVTREVDYTSQRLTENTRASYPIEYMANARIP |
| A0A0D2LSC9 | 77-138 | None |
| A0A0N1HNT4 | 319-374 | None |
| A0A7H4S6M9 | 70-137 | None |
| A0A1Q9CBJ7 | 332-397 | None |
| A0A380H4N5 | 2-77 | None |
| A0A4Y7IHK3 | 739-800 | None |
| A0A1Q3DZM1 | 301-372 | None |
| R6L9H0 | 67-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.