DPCstruct | MC36838
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 51 ± 1 aa |
| Standard deviation of domain lengths | 1.30 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 94.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 56.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07553 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380FIA2 | 13-62 | NYKENAVKKAKDYADSQDMSNDAIYDQLTSSYGEKFTEEEAQYAIDHLNK |
| A0A167YYY9 | 57-108 | IDNIEWNWKENALKKAQSYAETMSMSDSSIYEQLVSEHGEKFTPEEAQYAID |
| A0A2S5W4U3 | 331-380 | None |
| A0A853EH34 | 133-182 | None |
| A0A0R1HUD2 | 1-51 | None |
| A0A2G9VPN8 | 315-367 | None |
| A0A428D3L3 | 440-490 | None |
| A0A0U4WXI2 | 27-79 | None |
| A0A4R8Y5X4 | 37-87 | None |
| D6XW10 | 191-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.