DPCstruct | MC36836
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 87 ± 5 aa |
| Standard deviation of domain lengths | 4.75 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0270 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380FGW8 | 2-85 | SAGLFIVGRIKGVERPALVVTLPTISGKGFVFMDVGANAEAKPEHLLQYAQLGHIYAQKIRGIEHPSVGLLNIGTEAAKGNSLN |
| A0A496JXR3 | 20-104 | AAGFFIVGRIKNIDRPGLMSTLPTVDGKGFDMLDLGANAENTAQHLHQYAVLGSFYAKNVRGIAQPRVGLLNNGTESSKGDPLRK |
| A0A6F8Y858 | 68-148 | None |
| A0A2B4QYL9 | 316-397 | None |
| A0A0U5F1M9 | 133-223 | None |
| A0A3A9B5D4 | 14-102 | None |
| A0A1Q7N7M4 | 1-89 | None |
| A0A081BS61 | 117-205 | None |
| E9HPH4 | 36-125 | None |
| A0A812IMX5 | 522-607 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.