DPCstruct | MC36834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Standard deviation of domain lengths | 9.21 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380FG74 | 7-79 | IIASETCAIDVLGAEFVRDIHAGEYVVINDDGIRVESYTRHTTTAISAMEYIYFARPDSTIAGKKCTCSKKAI |
| A0A6N6XDH9 | 68-167 | PLVMGKRDIGDGRTEYMVASESVALDTLGFEFLRDVAPGEAVYITEKGQLFTRQCADNPVSNPCLFEYVYFARPDSFIDKISVYSAR… |
| S9SN41 | 30-108 | None |
| A0A1V5ITS3 | 1-78 | None |
| A0A7C0VC82 | 86-170 | None |
| A0A3D1P3D1 | 197-288 | None |
| A0A482SD63 | 1-92 | None |
| A0A7S3EHW5 | 58-130 | None |
| K1A7A0 | 166-244 | None |
| A0A379Z1J7 | 31-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.