DPCstruct | MC3683
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 122 ± 5 aa |
| Standard deviation of domain lengths | 5.14 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 77.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R1XX38 | 52-176 | SRTQKRKIAVNREQKLESDGLADKRRVLQEQGFSDLAIEIVVPNERCIKRKSRYYHVQQRFLDLRICNNITSAISAPQVVNYLAEIY… |
| A0A4P9XJU4 | 1-110 | MATKQHHLQACGVDQEAADVILNSNRQRARNKSHFSVQQRFVSWCKERAIDLSAASPAPVVNFLAHGRCQRDWSTGTVHTYGSAIME… |
| A0A1R1XJF0 | 601-727 | None |
| A0A1R1X9G1 | 117-238 | None |
| A0A2T9YVR9 | 158-281 | None |
| A0A2T9YFB7 | 257-382 | None |
| A0A2T9Y846 | 382-496 | None |
| A0A2T9YLA2 | 40-159 | None |
| A0A1R1Y0W8 | 151-275 | None |
| A0A2T9ZHG8 | 647-772 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.