DPCstruct | MC36828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 136 ± 17 aa |
| Standard deviation of domain lengths | 16.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0291 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K9YSL0 | 13-127 | EIASSPALASYINDFYKGCERISEVVAVTLDESLPQGKNWHQLLLNQVANTGDDRPPLWSQSLFLELDQYRKFRHLVLHTYSVDLDA… |
| A0A6N7IPE6 | 12-162 | LIGDLEDKMPSIENIAGKIHSLGQEINRISGKIPEEKLMALAGYLHHFYTGIEDILARIIKTVDGYMPRSGDWHSELLYISSRKTPG… |
| A0A843TBP5 | 4-123 | None |
| A0A1J4ZAG3 | 31-156 | None |
| A0A6L3SWQ9 | 2-110 | None |
| A0A7V2H734 | 3-145 | None |
| A0A7C3N5H6 | 387-527 | None |
| A0A3M8RB59 | 28-160 | None |
| A0A521WV41 | 4-128 | None |
| A0A7C4A9U8 | 11-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.