DPCstruct | MC36825
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 232 ± 53 aa |
| Standard deviation of domain lengths | 53.38 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 86.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1IJV0 | 3-243 | DLLYAWTLLRSHPSTQLDVRRIETSIAEMAGYIFNQEISTTCLENVMRLRGLHIPYVLMADRDPTWNWQQTSLSDAWREEARIVDKE… |
| A0A3R9GT88 | 2-279 | ALGLDIDKYFKKKRKSVISNVEEYIDDSVWMYYLIEEHQTENEVKQFLATNEISSHAILSFLQGEFDREVVKYNFNDSISMYDFYCA… |
| A0A432EH72 | 50-215 | None |
| A0A8B3C956 | 519-784 | None |
| A0A1W1EKK8 | 530-707 | None |
| A0A2A4U1U5 | 23-176 | None |
| A0A7X4Z9L8 | 706-1045 | None |
| A0A3A8JCM4 | 27-291 | None |
| A0A415Q9U3 | 116-353 | None |
| A0A2V8RY17 | 545-805 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.