DPCstruct | MC36814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 185 ± 19 aa |
| Standard deviation of domain lengths | 19.45 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 69.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 28.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A421DEZ3 | 12-193 | EGALSGHSNNNRNDNRDNRDNDNEFNPAARYAESHANTSGGDTSLFTSALSFLDENKHRLSSDSEINEQEMINAHQSLYGGDSEGRQ… |
| A0A2H3E7P1 | 1-173 | MSYAYYHQAPGWGSNQFHFGAPPAPTFQPQPSWGGMDYYRAHALSQADPHLFDNAWNRVRDFGSNSGGLGVGINEARHWHSRAYGGL… |
| A0A074S7L3 | 33-238 | None |
| B8PJ30 | 323-514 | None |
| A0A167N0Y3 | 77-279 | None |
| A0A397UGD7 | 6-144 | None |
| A0A2T3AFE4 | 2-166 | None |
| A0A1J8PFK2 | 4-215 | None |
| H0EGX7 | 488-674 | None |
| A0A077WCK7 | 4-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.