DPCstruct | MC36813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 169 ± 14 aa |
| Standard deviation of domain lengths | 13.76 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420SE01 | 16-154 | FNEGNELPPFEKATVENAKKLHLTNQLITTAADDVHTANDLGFDCDQFKASARGTSMAGILDTSGGFVAADKSCRLALYKARKHGVK… |
| A0A3R7IFK4 | 1-171 | MLRVQPIDKLGELEKETLANMERDGLRDMQFVKSSPEDRQRAESLGWEGKLLDTEIPDTETGQTYDAVLDSLAGFVRCSNACAYWQK… |
| A0A1L7WJG9 | 118-288 | None |
| Q4WGZ6 | 1-177 | None |
| A0A4R8QD77 | 66-242 | None |
| A0A507B1L7 | 132-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.