DPCstruct | MC36811
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 107 ± 9 aa |
| Standard deviation of domain lengths | 9.22 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M3LIN2 | 2-97 | GTTTPWGTADSSEKIARGIMSYSTPGHGGIHLSPTRQREMPEALKVESGWYEEDCDWCLVAIAYPDYFTEHYQIAVDTFRNWHPERY… |
| A0A6L6VKX1 | 28-126 | RAGASTPWGMAQVSRQFADGIVLHSTASHGGFHLAENANAIVHALYRNDTEFYEEDCEWAKVAHAFPQLFTAYERRLADRTLRDFYP… |
| A0A1U9LIJ2 | 181-282 | None |
| A0A1C3WBE3 | 106-196 | None |
| A0A416PD35 | 15-130 | None |
| A0A0F9R237 | 1-117 | None |
| A0A7T9EJ78 | 444-556 | None |
| A0A6L7TRD2 | 6-99 | None |
| A0A8A3LP37 | 90-188 | None |
| A0A3S6Z8H3 | 2-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.