DPCstruct | MC3681
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 120 ± 12 aa |
| Standard deviation of domain lengths | 11.88 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I1UVJ0 | 4-117 | SYSCEKLADHTYILRVQNNTKDTIQVYAGYNYPDTALNVEKPILKIGYPDYETRLESKTDWKDKLQGDTLSIFILSKDTVDTYSWED… |
| A0A519RH23 | 14-135 | ITSCKDDDVDGSLLLINDSDKNVYFYCFQDYPLMHYPDTILPVERPYGMQFIKKNGASGKFTNPSWDNIYSQLPDGKFSMYVFDADL… |
| A0A7Z9C9J0 | 5-129 | None |
| A0A2X2SW26 | 4-93 | None |
| R6XAZ2 | 45-181 | None |
| A0A563U0E8 | 2-123 | None |
| A0A0Q5SMN3 | 10-141 | None |
| A0A519MV54 | 5-124 | None |
| A0A0Q0S6M9 | 43-156 | None |
| A0A4U0NZ16 | 22-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.