DPCstruct | MC36802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 196 ± 43 aa |
| Standard deviation of domain lengths | 43.04 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03707 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3A1M5 | 28-214 | GGVGIWSMHFIGMIAFSMPNMNMGYDVWLTVFSLFIGIGVVYMGLKFIGNEFSIVKLILAGFVVGLGVAAMHYTGMLAMQVQANIIW… |
| A0A4Q3K564 | 23-203 | MPAAFEPVLTATSLTCAIVGIGAGVWISIRSRQRWQQFVAGLIVGVGVAMLHYVGQAAYLVQGTVAWDLGLVVPSVILSLPASGFAM… |
| C1DIM1 | 16-179 | None |
| A0A0G4KQ03 | 34-262 | None |
| A0A662WP88 | 192-493 | None |
| A0A090MGE8 | 10-179 | None |
| A0A3T0K3D9 | 10-188 | None |
| A0A563VYX2 | 23-185 | None |
| G4ZZ18 | 14-162 | None |
| A0A2N5CNE3 | 12-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.