DPCstruct | MC3680
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 94 ± 9 aa |
| Standard deviation of domain lengths | 9.33 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 19.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A559QMU9 | 2-86 | NMDGRVVLINEDINLAAIDLGLGQALVVRFPLEVMFDVGDLLQQLTTGYQEVRCVNVSKAQEITLQTLSGAMPMSVAILVVGCGQ |
| A0A519RF94 | 51-154 | QMPSVIPQINYSDNQISSSSNSGTVVYKPSSCDYFIIENSRGFIIAEWMGGNDPDLGDQISGELNSYGTKDFYNLTRESSGRIWIDD… |
| A0A318SQ87 | 1-84 | None |
| A0A0G9HD93 | 40-127 | None |
| A0A509DVH6 | 25-121 | None |
| A0A1E5Q7I5 | 44-125 | None |
| A0A1G6HK50 | 7-115 | None |
| I4AIF8 | 133-220 | None |
| I4AIF7 | 212-301 | None |
| A0A348ZW11 | 4-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.