DPCstruct | MC368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 58 ± 3 aa |
| Standard deviation of domain lengths | 2.59 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 54.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00673 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V0MAD7 | 1-59 | SFDSEGNFTIGIREQTVFPEIDYDEVNKIIGMNITIVIDSKDKKMNYELLKMFNMPFKK |
| A0A7K1GGL1 | 25-82 | FDGRGNYTLGVKEQLIFPEIDYDKVSKVRGMDIVIVTTANTDEEARELLANFGMPFRK |
| A0A6A3B157 | 27-84 | None |
| A0A1W1B8M3 | 56-113 | None |
| A0A800DT63 | 77-134 | None |
| A0A7V9MK44 | 89-145 | None |
| A0A2E4WLC2 | 125-181 | None |
| A0A7G8PUN1 | 125-182 | None |
| A0A7X9JP50 | 20-78 | None |
| A0A7E4RZW0 | 500-553 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.