DPCstruct | MC36798
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 59 ± 9 aa |
| Standard deviation of domain lengths | 9.13 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W1U6J4 | 28-81 | EINYLRCILCGMCIEACPTRALTMTNDFKMADTSRAKHIWTKDELLAPLKEGME |
| A0A650BKH2 | 5-60 | GSIDFGVCIFCGNCVEYCPTNCLSMTEEYELSTYDRHELNYNQISLSRLPMSIIGD |
| A0A7C5YB36 | 76-136 | None |
| A0A7J3MSL5 | 94-151 | None |
| B3T3F6 | 1-58 | None |
| A0A7C7KZP8 | 134-200 | None |
| A0A4D4K8P1 | 25-105 | None |
| A0A7K0PI68 | 1-63 | None |
| A0A7J3VU81 | 232-301 | None |
| A0A7C2LGL3 | 9-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.