DPCstruct | MC36795
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 159 ± 22 aa |
| Standard deviation of domain lengths | 21.86 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20249 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I2I8U5 | 24-207 | CKACHRKGLPILPLRVSAVPQRVVSSFWQPEVPPQDVALSGGEYKYALRTLRAGYLYVLLDKTIWQGYQVMKEGYLRQFNPLVMPED… |
| A0A379G8Y6 | 9-163 | GCSFCQRRGLPILPVRPAIMSQQDVLPVMPKHIQTPALAQGETAYTLRLLRSGYLNIWDERGNSWINYFVTENGFYYPLPENGEVPE… |
| Q0PZH3 | 9-175 | None |
| A0A2R7RAZ3 | 23-184 | None |
| A0A7Y1Q8U7 | 16-164 | None |
| A0A1B9JHC2 | 46-209 | None |
| A0A1B8P158 | 4-146 | None |
| A0A317PV85 | 32-201 | None |
| A0A7D6TYY0 | 24-163 | None |
| A0A3A1VWQ7 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.