DPCstruct | MC36790
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 237 ± 24 aa |
| Standard deviation of domain lengths | 24.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 12.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661PI33 | 1-253 | MARHAFAGVTLLALGVASTSCDSIRLQTVDTHETVLSRTREVIPGPSVRVQTRLRDTTLVVQTMQGCDLVEQERVRVVEIRESDEDL… |
| Q096F1 | 136-369 | GGLVLAVGCAPLEVERRVERGPVLRTYTQEVALGEKGLVAEVEAQWPRLTFRFLSSEVCRTEKHEEFIESVITEHYESSAAPALSAG… |
| A0A2W4LZI2 | 50-316 | None |
| A0A356RBU1 | 7-251 | None |
| A0A2E8G7B6 | 1-214 | None |
| A0A356SZ48 | 2-272 | None |
| A0A0C2CNH0 | 2-244 | None |
| A0A3M2V3T3 | 102-324 | None |
| A0A5Q4F6S9 | 71-310 | None |
| A0A0K1QF43 | 3-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.