DPCstruct | MC36781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 113 ± 6 aa |
| Standard deviation of domain lengths | 6.33 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 37.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452STX3 | 327-432 | AKVLINPQPLTTFQQIIKDKKESVYLSNQSAPLGKSHDQTPGLPKGLDVLNTTFGTTVIRESSARDVVNPPQPYEEVFKEGKEGHDL… |
| A0A5K4EPU9 | 1-120 | MTDSETEIMDLIIPPKETLLSEIITRNQEAIYDSTKKRPLGCSSLRDLPPHLDKYKTTFGMIYEKGDRAGDLINPPRKRIDITNEEL… |
| A0A2K6EL07 | 337-441 | None |
| A0A7E6F334 | 123-238 | None |
| A0A8B6CF55 | 61-165 | None |
| A0A1S8VRT5 | 65-179 | None |
| A0A212CI73 | 45-164 | None |
| A0A5J4NNR8 | 13-125 | None |
| A0A2K5J470 | 203-308 | None |
| A0A2U9CLL4 | 25-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.