DPCstruct | MC36780
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 128 ± 17 aa |
| Standard deviation of domain lengths | 16.76 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K4EJN2 | 23-161 | NKPYKVSIFDSWNTCKHADGNQPDFRNVPTVSTILSKTTPLESTIALRKWQDKKKNELGEDGFQEYMRELQLLGKSVHSSVEARLTK… |
| U5QRD6 | 23-134 | YPGVTTILAATRPPEAIEALERWRNRVGVEQAQAIQVAASGRGNRLHALVEQYLRGEPVDTDQAAALQPWWGSVQPALRQIADVRLV… |
| A0A3P8CT98 | 57-207 | None |
| A0A3Q0JC28 | 45-192 | None |
| A0A182TNC9 | 45-171 | None |
| A0A6S7G3Y2 | 83-197 | None |
| A0A0N5DAH2 | 50-179 | None |
| E4XQ63 | 82-208 | None |
| H0XVT4 | 71-226 | None |
| T1JWZ8 | 157-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.