DPCstruct | MC3678
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 200 ± 18 aa |
| Standard deviation of domain lengths | 17.89 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 19.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R5CXQ5 | 3-216 | NKENLKNHFSERIDQNFDELKKYYNHNLIEMCEINSLKMEALNCLLFGLYTASITSTSHLLERTMKMALIKFETKGLTYSDFEKYNK… |
| A0A519QNL4 | 5-186 | LMVEFHQPEFDILRREIGRCFVINAYHACITLTNHLLERYCKILLISFESGFKTIVELESLESIFEAANKKYLKADLNETLNACRTL… |
| A0A0E3PMG1 | 170-365 | None |
| A0A5C5VQX9 | 3-211 | None |
| A0A0G1B6V3 | 43-242 | None |
| A0A0E3LKS4 | 2-186 | None |
| A0A0Q4GVU1 | 1-212 | None |
| A0A1V5UXP4 | 40-241 | None |
| A0A7G9YLX8 | 4-212 | None |
| A0A3D9C2K0 | 32-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.