DPCstruct | MC36779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 120 ± 12 aa |
| Standard deviation of domain lengths | 11.94 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A1Z971 | 1-109 | MPCESCGVEFTVFRRKRACFDCKRYYCANCIASRRCKRCSVFAQRPLSRTDLLKLKPKDLIFYLQSKHISTEGCLEKEELVGLVLTH… |
| A0A6P8ZGL9 | 25-145 | VCEICGTKLSVFRKKKPCLECKKQFCSQCLLRGRDRTLHCKNCYILCMRPPLRSALLNLRIKDLQHYLNQHNVSTRGCLEKEDLVNV… |
| A0A182FFU6 | 32-142 | None |
| A0A2I0TV45 | 4-125 | None |
| A0A819TVS1 | 11-138 | None |
| A0A1A9X3Q0 | 368-490 | None |
| A0A182MQZ2 | 1-116 | None |
| A0A1A9USS2 | 1-123 | None |
| A0A286XXA7 | 1-105 | None |
| A0A3B3QPV0 | 61-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.