DPCstruct | MC36774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 105 ± 23 aa |
| Standard deviation of domain lengths | 23.16 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10170 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A146MJ75 | 2-86 | SSEIQNELFHCSVCDLKIRYDYKGDKPPFFKKDIKLLESVYCIRDPFADDNLGGIILGGDCSVCRRSVCISQDCSTYNMKRYCIC |
| A0A1S3INF3 | 1-94 | MTSKFLCSKCGFCINYDYFGNKPPGADTLLLLEEAYIMNDPFAENRRGKFIILGSHCSVCSKSVCIAQGCSIFYTKRFCIDCVIKNL… |
| Q8R3A2 | 2-101 | None |
| A0A556THD0 | 1-74 | None |
| A0A7N4NNP8 | 506-598 | None |
| A0A7N4NZX8 | 130-222 | None |
| A0A835NW08 | 69-166 | None |
| A0A834AVY9 | 51-153 | None |
| A0A061RIH7 | 1-93 | None |
| A0A0N5CJS3 | 12-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.