DPCstruct | MC36768
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 251 ± 45 aa |
| Standard deviation of domain lengths | 44.74 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090FEA2 | 1-217 | MNRLIEARANIDLASQNAPDTIANTGNYSGAMPSAADFAAVYGVEEGGKRYQEFGRKIDAGRQAFGLRTMPNQAIQALLSNTVSGAT… |
| A0A528KQP2 | 86-295 | SQLVGARANISLAFQNAPKAFADTGSYAGVMPKPEDFAYVFGVEEGRRQLAKFDQSVGTGKQAFDMRVMPARDINSQLLDAAVGAAN… |
| X6FZG8 | 74-282 | None |
| X5YR70 | 249-573 | None |
| A0A6M7WLH0 | 132-363 | None |
| A0A6A8AE49 | 239-471 | None |
| A0A5F2HX24 | 120-418 | None |
| A0A0K2VYM7 | 320-560 | None |
| A0A2X3KFV4 | 130-467 | None |
| A0A4S0ZNQ6 | 308-542 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.