DPCstruct | MC36760
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 231 ± 30 aa |
| Standard deviation of domain lengths | 29.61 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 41.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813LRL4 | 96-328 | FCRGTNAFFGQLVIPQIRELVKLQPAGTAGSNLLDKLTAAPETPGISRPLWVVMAGSIPTALIWYGYYKFSVEEELFQAELRKEGRV… |
| A0A7R9YQ10 | 60-297 | CRAVNFACRQTVVGSVRRAVALRRAPEQPGERGFAGFLAKATSPPELPPVSRPTWLVIAASVPTLLGWYGFYKFSTEEELFWEELRT… |
| A0A7S1DVW5 | 79-337 | None |
| A0A1E7FT21 | 1-215 | None |
| K0RFC5 | 57-304 | None |
| A0A448ZMR4 | 59-330 | None |
| A0A7S0UHL1 | 1-244 | None |
| A0A7S2XY30 | 33-260 | None |
| A0A7S1CZ01 | 22-253 | None |
| A0A2V3J3R1 | 52-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.