DPCstruct | MC3676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 168 ± 16 aa |
| Standard deviation of domain lengths | 15.57 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 53.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I9ZP31 | 1-174 | MKDFMSTQGFITKYKYSYSDYAQETQRLKSFLDGKRDFLGYIQAIGYWKEEVENDILPNKEISFFVFQNEPSKTFDLRNYLLLLARL… |
| M3MEL3 | 71-244 | DRFLKNNAKASVKDFISSKEFVNKYRYTPKQNTEKAKKLQSYLESKRDFIGFVQTLNSLKDSPQDLFLPNEETSFLVFANEPTIIFN… |
| T0E447 | 2-169 | None |
| A0A514UQC3 | 15-151 | None |
| J0MYN6 | 151-312 | None |
| A0A7K1MTX9 | 87-252 | None |
| I9VUX1 | 8-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.