DPCstruct | MC36759
Metacluster Properties and Pfam Annotations
| Number of structural domains | 200 |
|---|---|
| Mean domain length (aa) | 102 ± 15 aa |
| Standard deviation of domain lengths | 15.25 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.62 |
| Pfam Score | 99.52 |
| Assigned Pfam label(s) | PF01161- PF01253 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9YLU2 | 32-132 | VEVDGFEPRERKGALPPIIISMGRAAGHNKTSVSGLETYHVDPDELARYGKRLFNCTTSVAELPGKYVREKEVTLQGHCVSEMVEHL… |
| A0A812GKH2 | 16-97 | VVNATKKGGLPIKVESRAKGKKVTIISGVQGDAQSLVSALGSLLGCGGSVCHAAGQTQVLVQGDQTERISGSLEQLGCLRGM |
| A0A4V3WL97 | 82-171 | None |
| A0A6I9K736 | 78-200 | None |
| A0A4U0VPU3 | 326-423 | None |
| A0A1E5UP09 | 74-172 | None |
| A0A0F7SUM9 | 33-150 | None |
| A0A0F7SGV7 | 741-839 | None |
| A0A7R9L011 | 117-218 | None |
| A0A183LNU1 | 69-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.