DPCstruct | MC36755
Metacluster Properties and Pfam Annotations
| Number of structural domains | 136 |
|---|---|
| Mean domain length (aa) | 240 ± 47 aa |
| Standard deviation of domain lengths | 46.86 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 72.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 22.54 |
| Pfam Score | 88.16 |
| Assigned Pfam label(s) | PF04578- CL0184- CL0523- PF13968 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q5Z830 | 43-278 | LHKSANVPTQVKAAVLAALKRSNGRLSNGVAAIQRSTLRDTVIWSCQGDHIVTANVILVWHIGTSLFEMKYLRIKSSPRTADMITAT… |
| N1QXE4 | 1-155 | MKNVSSDEENKLRPHLDVATKLSKYCAYLLVSARKLLPGRPYDTLCVLDAVAVEATVFLKNSRDKYEVMRNLAGSEETIFEGGAKLG… |
| Q7XS29 | 38-346 | None |
| A0A2N9I9Z8 | 40-315 | None |
| A0A4S4DXG3 | 6-195 | None |
| A0A438DK32 | 1-213 | None |
| Q7XRV7 | 682-941 | None |
| A0A6P5MZU5 | 310-594 | None |
| A0A4U6TG15 | 12-219 | None |
| M7YL00 | 751-1029 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.