DPCstruct | MC36753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 170 ± 17 aa |
| Standard deviation of domain lengths | 17.35 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A7MVL6 | 3-154 | DPAFREAREAFIGDRPAGWLYENGTMLGQVNTVLGGPPDEPVYFSDNLVRFSACRPHSCDEKGAVVLTTDGEIVAVGVLHFDNSRTR… |
| A0A4R8LEL6 | 130-296 | QGAVEAFTRHAELNFADLGEGEKTPVSDRILDGFEAAPSLLVTPDGSSIRWGFKYQEASLQSVVINAPSGEPALLAAVDGVSRLTRR… |
| A0A5R9PHM3 | 203-405 | None |
| A0A508A701 | 10-184 | None |
| F9ZTN3 | 151-331 | None |
| A0A2U1G4G6 | 217-363 | None |
| A0A2V9F7R5 | 11-185 | None |
| A0A1H5T514 | 43-246 | None |
| A0A6B3UH77 | 1-167 | None |
| A0A7Y1MFT7 | 1-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.