DPCstruct | MC36752
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 77 ± 5 aa |
| Standard deviation of domain lengths | 5.41 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12616 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H8QTE6 | 24-104 | AELRAFIDNLNEDEQASLVAVMWIGRESFTADDLEEAIETARAEATTPTADYLIGTPHLSDHLENGMDELGISLSDEEDDL |
| A0A5A7MV41 | 1-73 | MFIDDLNEEERIDLVVLMWVGRGTFGPDELEQARRDASREATHATSEYLLSTPLVAVYLADGLEAFGLEVEAD |
| A0A560KDC6 | 55-142 | None |
| A0A6N8XPT3 | 164-236 | None |
| A0A418ZWD3 | 14-92 | None |
| A0A1Q3KPP3 | 23-93 | None |
| A0A1E3W905 | 3-72 | None |
| A0A354U0Y8 | 3-83 | None |
| A0A7C4ZJ16 | 32-115 | None |
| Q89CA8 | 88-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.