DPCstruct | MC36750
Metacluster Properties and Pfam Annotations
| Number of structural domains | 160 |
|---|---|
| Mean domain length (aa) | 220 ± 25 aa |
| Standard deviation of domain lengths | 24.97 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.39 |
| Mean intra-cluster sequence similarity (%) | 12.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T5PAY1 | 3-224 | RCLLCGNESKLVESHIIPDFLYKDVKDRNGKIASVNLKEDSSRFLNKGLFDRNILCAKCDNEKLGSLEYDASSALKNQIYPVITNID… |
| A0A6L9UIU1 | 19-211 | KQCFACGRTPTTGAGEHVIPKWLQSKLGLFDERLTLLNGTQIPYRSLTVPCCAECNNGFLSAIEREVHPIFTRGTLIAGDELVLGRW… |
| A0A2E2QGV4 | 2-209 | None |
| A0A1I0SED6 | 7-228 | None |
| D8IB44 | 102-349 | None |
| A0A2A4ZPY9 | 1-160 | None |
| W9ARI6 | 2-187 | None |
| A0A1H9XU70 | 46-267 | None |
| A0A3C1VDF0 | 34-281 | None |
| A0A2P6BXY6 | 3-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.