DPCstruct | MC36744
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 99 ± 18 aa |
| Standard deviation of domain lengths | 18.31 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 94.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A286E9E0 | 19-114 | KHFTEFGATHSTVSGSLKADPHIVKMMNAMNFQSKTKYYRIRHGVNDRDTSLAIPALLALKLQNENKDVDFSLPWGQGHGGDDDLDE… |
| A0A847JXC7 | 78-161 | AEPATVHMMNPMSYIGAKGTVTASHWRIRHGTVDRDTSLAIPVILAAMLQNAGAKVDFAMPWGQGHGGDYDLPELFAWIDAICR |
| A0A328SCJ7 | 43-132 | None |
| A0A380FB94 | 7-96 | None |
| A0A378MXY3 | 96-172 | None |
| D9TTI3 | 153-247 | None |
| A0A660E6I3 | 183-272 | None |
| A0A3A1YL47 | 649-769 | None |
| A0A086H2R0 | 2-74 | None |
| E7N1K1 | 243-357 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.