DPCstruct | MC36743
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 69 ± 10 aa |
| Standard deviation of domain lengths | 9.85 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V1RCF7 | 191-261 | GTRGPSRDQEGVMAVDEATKKRIDRWIKQKGLNPYGDPQGTMYLGGTPLFDERTGRTKDRYEYILERHPEL |
| A0A212DY61 | 49-110 | ILLLSRQEINRIEKWIKDNDLNKYGDPADTFYIGGTPLFDEKTGEKISRFNYIAKKYPDKPW |
| C1MTF8 | 67-136 | None |
| A0A534W1R3 | 9-82 | None |
| A0A3D1R1N8 | 6-74 | None |
| A0A1V9YQ09 | 334-390 | None |
| A0A534Q3X5 | 13-76 | None |
| A0A848LMI6 | 73-164 | None |
| A0A2N6A9P3 | 57-127 | None |
| A0A1F5SEJ6 | 105-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.