DPCstruct | MC36739
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 163 ± 27 aa |
| Standard deviation of domain lengths | 27.09 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06695 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523V597 | 7-161 | AWVLLATVSPISELRGGIPLGILKYGQDPLFVFCIAVIANALLFFPLFLVLRLLYGKLFSRIPLFDRYLDNLRKRGEHKVEKYGFWG… |
| A0A833EAQ0 | 69-213 | TVVLALTGLLPAFEPRYALPLLAAKIGFVPAFAVAATEAILLALVLPSIAQRAWGLLLDYSRRLRFLGLLVARVEAAQQRARRLTSR… |
| A0A7Y4WJE0 | 1-221 | None |
| A0A256YTW4 | 32-245 | None |
| A0A1I3ZVI0 | 5-154 | None |
| A0A2D6NWL4 | 7-138 | None |
| A0A1D2QYI9 | 2-133 | None |
| A0A2P6VT94 | 51-199 | None |
| A0A2K3J3A1 | 31-230 | None |
| A0A7X6UMR8 | 9-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.