DPCstruct | MC36731
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 330 ± 72 aa |
| Standard deviation of domain lengths | 72.06 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 78.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 26.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H6KK70 | 1-381 | MATAIKLDTLKECLQFLEWLHKDKKNGVKTKVATQLSNRLTGKYNNVDHQQIQQALSQFLTNVSKFHNKLCNKANQKQIGSNPNAVL… |
| S6B7V1 | 27-352 | LLACITPTVPRTLGDLFGFYYYIVYIGGNSSGGGGKKEVYQKLEKELRDVRLSMLGSGNDAVVKALENWSDSGSGCTSGCKDTLRCL… |
| A0A2H6KKM2 | 162-590 | None |
| A0A061BIT0 | 181-547 | None |
| A0A061BJ75 | 20-216 | None |
| A0A061BJY2 | 936-1243 | None |
| A0A061BL59 | 110-372 | None |
| A0A1X1BQ56 | 2-232 | None |
| A0A061BLA0 | 1-189 | None |
| A0A061BTJ2 | 703-1080 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.