DPCstruct | MC36728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 94 ± 5 aa |
| Standard deviation of domain lengths | 5.18 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 95.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 47.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A447P922 | 1-96 | MKPHWEISQQEADACLAATEWCPAIHEYFRGGGYSSRFLTEGGVPFTMTPREYQSKGLGPVLQIAEGWSVELPKAMHDQLDARTNLY… |
| A0A379BFH2 | 251-344 | KPAWEVTEEDGKRCLAHTRWCPAVHEYFRGGGYSSQFLTKGGMPFTMHRLNLIKGIGPVLQIAEGWSIDLPEQVHDILNKRTNETWP… |
| W4TUM6 | 49-140 | None |
| A0A377Z6P9 | 55-161 | None |
| A0A7X8EE10 | 165-259 | None |
| A0A378AHE9 | 1-95 | None |
| A0A1V5GU42 | 232-316 | None |
| A0A373PT84 | 1-89 | None |
| A0A7U9XMI1 | 360-453 | None |
| A0A0S8H7A7 | 137-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.