DPCstruct | MC36727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 156 ± 14 aa |
| Standard deviation of domain lengths | 13.87 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A336N3F3 | 1-164 | MIATFIVVLALMLPAIKLDNLMAMPIDNALIISASPVFFTAFGFHGSIPSLNKYLDGNVKALRIAILVGSGITLFAYILWQLSTHGL… |
| A0A447P6U8 | 10-161 | VITFFLTFGSLLGHVQPATLFNVAESHASYTPYLLMTLPFCLASFGYHGNVPSLMKYYGKDPRTIVKCLIYGTLLALALYSVWLLGT… |
| A0A448MJD5 | 2-149 | None |
| A0A2R7RA12 | 3-170 | None |
| A0A6S6RQ60 | 2-164 | None |
| A0A6D0J5R8 | 13-157 | None |
| A0A6M1CNC3 | 3-131 | None |
| A0A0H3ZWR1 | 51-198 | None |
| A0A6I3JRQ2 | 2-157 | None |
| A0A0H3ZKL7 | 44-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.