DPCstruct | MC36726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 136 ± 12 aa |
| Standard deviation of domain lengths | 12.48 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 71.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07095 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A447N2S1 | 1-139 | MKGAQAIEATTVKQLEKAGVRVGDTLHLSGKGMCNIHSGATWSGQSNSPFMPFDCSQIIWNDAPALPLPESDLVNKAMALSQAVNRQ… |
| A0A378EAJ4 | 1-108 | MRIGDTLRLTGTGMCNIRTPGSWSAKEDSPFLPFDCSQIVWNDAPPLPLPESDIVSKATALMQSVQRQLHPETDDDSRVSPALRSAI… |
| A0A3S4DVU8 | 1-117 | None |
| A0A376TWS6 | 42-181 | None |
| A0A376S1E9 | 358-497 | None |
| A0A378AKY9 | 1-161 | None |
| A0A655DLB9 | 30-169 | None |
| A0A6N8Q9Y5 | 46-184 | None |
| A0A379FKQ4 | 1-135 | None |
| A0A2X2WG00 | 130-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.