DPCstruct | MC36724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 87 ± 9 aa |
| Standard deviation of domain lengths | 8.76 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0139 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453KK46 | 134-227 | STLRGLLETGDKILRIEGIFSGTLSYIFNNFEGTRSFSDVVAEAKEAGYTEPDPRDDLSGTDVARKVIILARESGLRLELSDIPVES… |
| A0A447MYQ6 | 5-89 | ENLQNLLNAGDELQKFSGILSGSLSFIFGKLEEGMSLSQATALAREMGYTEPDPRDDLSGMDVARKLLILARETGRELELSDICD |
| A0A4P0XNZ8 | 3-87 | None |
| A0A444FJM7 | 1-71 | None |
| A0A2K1KJT3 | 344-432 | None |
| A0A7S3SBF8 | 230-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.