DPCstruct | MC36721
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 159 ± 21 aa |
| Standard deviation of domain lengths | 21.16 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A447MVD0 | 9-170 | SFGRMDQYLYPYYRRDVELNQTLDREHAIELLHSCWLKLLEVNKIRSGSHSKASAGSPLYQNVTIGGQNLINGQPMDAVNPLSYAIL… |
| A0A3E2BCF8 | 618-785 | WTVESLFEIEENQTGLSLGRLDQYCLPMYENDIKTGRLTQDQALEMMQAFIIKCAELMWMSSELGAKYFAGYQPFINLTVGGQKRSG… |
| A0A6G3I5S2 | 132-303 | None |
| T0E668 | 211-329 | None |
| B0N617 | 226-363 | None |
| A0A377ZC21 | 58-234 | None |
| A0A7V1MKZ1 | 194-376 | None |
| A0A1Y1UIZ4 | 141-290 | None |
| A0A1V5GIN8 | 151-303 | None |
| A0A5K8A291 | 288-445 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.