DPCstruct | MC3672
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 187 ± 35 aa |
| Standard deviation of domain lengths | 34.91 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0362 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L4B0U8 | 38-266 | VLGASLKGALRAQARRDGRRDEDIRRVFGADPGEALFRGATSFGDGVLLIFPARSFTSTFALLASPLTLGRFARQVSGAPEIPMPSS… |
| A0A832Z3Z9 | 31-243 | PSASHGYVYLTSPYLLKRALGLLEVLKTEGVEKADELYSAVNELLNEIEDGKSYSAIGGDVDVGGTLIHTETLKNVDFLDEELLNSL… |
| A0A538Q7R4 | 39-180 | None |
| A0A661RZI2 | 41-257 | None |
| A0A7V5YRW3 | 7-171 | None |
| A0A497RQ16 | 63-311 | None |
| A0A662J7W2 | 14-290 | None |
| A0A2H5VF06 | 4-196 | None |
| A0A800BN38 | 19-184 | None |
| A0A1V1PGC3 | 9-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.