DPCstruct | MC36711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 116 ± 12 aa |
| Standard deviation of domain lengths | 12.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 45.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F8GX19 | 19-108 | IGFSTMAGQTGGGKQIVGFLGIGVAYFYSPKFIQADGGWNRVVWLPSMLKEKIDETIPADLKDKIATEKDATDIQSLKAFLQEKNHP… |
| A0A7J4E445 | 90-212 | TSCGCFEAIAFYIPEVDGMGIVHRDFKGVTVNGLPFSTMADSTAGGRQVDGFHGISIEYMRSPKFLQVDGGWNRIVWMPAEVKERVK… |
| A0A2H6JX87 | 276-398 | None |
| A0A7C0Y7L3 | 349-482 | None |
| A0A7X7FKE1 | 74-188 | None |
| A0A1F8R3F6 | 131-242 | None |
| A0A0U1KYA8 | 250-365 | None |
| A0A2G9XHP9 | 312-434 | None |
| A0A564Q4Z8 | 150-268 | None |
| A0A2G9XD42 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.