DPCstruct | MC3671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 344 ± 36 aa |
| Standard deviation of domain lengths | 35.74 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N1MU91 | 6-306 | DGQYYTDIQKKKKFLGITTSTRYSTQYSEASAELERQFSLIFTGFYDAISAAAGPLGLSLDEVQARLDSFVINIGKIDLKGLTGAQI… |
| A0A0B5DZ39 | 1-344 | MPLVGAATALVGLVKGFSSKKLTGAGLEFSWTGDALAGGTYETWKKKSWWGLKSSTSTKLKAFDEETNAALTEQAEAVQKAVAAAYK… |
| A0A0A6D0H6 | 128-519 | None |
| A0A1I3VP62 | 128-462 | None |
| A0A0A6F687 | 260-651 | None |
| A0A1I9XW43 | 447-792 | None |
| A0A1E8PTM1 | 2-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.