DPCstruct | MC36708
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 252 ± 28 aa |
| Standard deviation of domain lengths | 27.95 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20658- PF20656 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6RVW9 | 43-298 | TGKYVDFGDIQVHEILKDAVEKNILPGTGVSPQEFWSYLEKLLAEFSDENAALLAHRDELQAAIDEWYRDGCKEDQEKFLKRIGYLV… |
| A0A455ULG0 | 1-264 | MSQRISRHRLQVAADLDRFINEQALPGTGIDENAFWAGVDALFHDLTPKNRQLLEERDTLQEKLDVWHRENPGPVADMPAYRRFLKE… |
| A0A6A5LBG1 | 241-463 | None |
| C5LI07 | 5-261 | None |
| A0A814BNM6 | 2-266 | None |
| A0A813TZ27 | 2-257 | None |
| A0A820BB15 | 1-286 | None |
| A0A7J6Q8E2 | 467-722 | None |
| A0A1E5A0A8 | 1-318 | None |
| A0A7S4KK00 | 46-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.