DPCstruct | MC36707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 203 ± 33 aa |
| Standard deviation of domain lengths | 32.76 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2KC66 | 9-246 | EKKKKRSSGNFKERKTDVESTLIKHTEGQKWYSYQVNKLSQGPQNLDDQAVRTLFQEAEQLYNQEVVNYVKEAQKSGGSEASWLFQV… |
| A0A0C3FI96 | 127-322 | VVKPVKPAAPESKRPKSNFVVEPTSQWYIALPALPPPTAPTPALTAAKLVSLTTHAATLHANTIATYQSQSSSTATNTTSDFSFLQK… |
| A0A067D2C3 | 56-316 | None |
| A0A0N5AW42 | 397-553 | None |
| A0A2H9TL09 | 636-844 | None |
| A0A1Y3BQB9 | 10-212 | None |
| F0WJT1 | 180-323 | None |
| L0PB37 | 3-180 | None |
| A0A5A8ENN7 | 156-415 | None |
| A0A1J1HRY9 | 3-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.