DPCstruct | MC36704
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 124 ± 6 aa |
| Standard deviation of domain lengths | 5.56 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J5TKB6 | 1-124 | MSSLASQLKNIASLDADRLTSRTGAPSSKSYLFPAKVAATQDLDAVHALGQSGFDELVQLDPQMEEFEEELFSEAAKRTDRMMLSEE… |
| A0A6J0N6F9 | 4-124 | SLASQLQAIKSIVQADTEPSKRPYTRPSILFTPKEAADLDIESIHELGLKGLEVLGNKDERFKNFANDLFSHKSREIDRELLSKEEN… |
| G0UTH8 | 1-117 | None |
| A0A2P4XI43 | 2-123 | None |
| U4UK79 | 1-122 | None |
| A0A7J7QBC8 | 7-137 | None |
| S9XAT3 | 29-149 | None |
| A0A0D2N348 | 1-121 | None |
| A4S122 | 1-126 | None |
| Q9VM75 | 5-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.