DPCstruct | MC36703
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 113 ± 6 aa |
| Standard deviation of domain lengths | 5.51 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 59.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183M628 | 51-165 | ARYLFRLYMVLKQYKEAARTAVIIANEEQINGNYRNAHDLLFSMVQELRQRNIHVPFEMFENLTLLHSYILAKVHVKNGEHLLGARM… |
| A0A7J6RBU4 | 3-120 | TCQAQSIYKLHQVLGNYEESARIAMLIAKREQEEGRYKAAQSLLLKTYKDLDRLKMRIPREMWERLMLLQSYILVKPLAQLDEHVNA… |
| A0A5K3EM75 | 17-131 | None |
| A0A1S8WZ31 | 133-230 | None |
| A0A1S3QGU5 | 133-247 | None |
| A0A2S2PAJ4 | 189-303 | None |
| A0A388JTS2 | 604-716 | None |
| A0A2J7R2K9 | 641-755 | None |
| A0A0X3PB08 | 950-1064 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.